DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and PRSS3

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001184026.3 Gene:PRSS3 / 5646 HGNCID:9486 Length:261 Species:Homo sapiens


Alignment Length:48 Identity:9/48 - (18%)
Similarity:22/48 - (45%) Gaps:13/48 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DCSISRIEPKSLQK--VQHIQV-----------ILLSRNQITRISHDT 361
            ||:...:|..:::|  ..:|:.           .::.||..:.::|:|
Human    23 DCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473
PRSS3NP_001184026.3 Tryp_SPc 38..256 CDD:238113 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.