DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and PRSS1

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_002760.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:247 Species:Homo sapiens


Alignment Length:32 Identity:9/32 - (28%)
Similarity:16/32 - (50%) Gaps:5/32 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 KVLSMSNNKDITSIQANGKLSVQQFKLCICIL 312
            |.:|..|:.|:...|:..|     |::.:|.|
Human    82 KKMSCPNDSDLFCFQSETK-----FRMTVCQL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473
PRSS1NP_002760.1 Tryp_SPc 23..239 CDD:214473 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.