DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and KLK15

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:268 Identity:77/268 - (28%)
Similarity:124/268 - (46%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWII 68
            :||.|....:|.|:|       ..::::.|:|.|....|:|::|  ...|..:||.::|...|::
Human     3 LLLTLSFLLASTAAQ-------DGDKLLEGDECAPHSQPWQVAL--YERGRFNCGASLISPHWVL 58

  Fly    69 TAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPD------RIVEHSNYAPRKYRNDIALLHLNES 127
            :||||    |:...||..|..:|.:...    |:      |::.|..|..|.:||||.||.|.:.
Human    59 SAAHC----QSRFMRVRLGEHNLRKRDG----PEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQP 115

  Fly   128 IVFDNATQPVELDHEALVPGSRLLLTGWGTLS------LGG-----DVPARLQSLEVNYVPFEQC 181
            ...:...:|..|......||...:::|||.:|      .|.     .:|..|....::.:....|
Human   116 ARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC 180

  Fly   182 RAAHDNSTRVDIGHVCTFNDKGRGA--CHGDSGGPLVHNGKLVALVNWG-LPCAK-GYPDAHASI 242
            ..::..  |:....||. ..:||||  |.||||||||..|.|..:|:|| :||.. ..|..:..:
Human   181 DKSYPG--RLTNTMVCA-GAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKV 242

  Fly   243 SYYHDFIR 250
            .:|.::||
Human   243 CHYLEWIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/240 (29%)
Tryp_SPc 30..252 CDD:238113 71/242 (29%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.