DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and epsilonTry

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:231 Identity:71/231 - (30%)
Similarity:117/231 - (50%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQ 93
            |||||.|.:....|||:|||..||  |.|||:|.....:||||||.:..:|...::..|:.....
  Fly    30 RIVGGYETSIDAHPYQVSLQRYGS--HFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRS 92

  Fly    94 NGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTL 158
            .||.:.... ...|..|..|...||||::.:...:.|.::.:.:.:.......|:..:::||||.
  Fly    93 GGSVHSVRS-FRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTT 156

  Fly   159 SLGGD-VPARLQSLEVNYVPFEQCRAAHDNSTRVDIGH--------VCTFNDKGRGACHGDSGGP 214
            ..||. :|..|.::::..:...:||:.       :.|:        :|.:... :.||.||||||
  Fly   157 ESGGSTIPDHLLAVDLEIIDVSRCRSD-------EFGYGKKIKDTMLCAYAPH-KDACQGDSGGP 213

  Fly   215 LVHNGKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249
            ||...:||.:|:||..|.. .||..:|.::::|::|
  Fly   214 LVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 70/229 (31%)
Tryp_SPc 30..252 CDD:238113 70/230 (30%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 70/229 (31%)
Tryp_SPc 31..252 CDD:238113 70/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.