DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and KLK14

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:254 Identity:83/254 - (32%)
Similarity:126/254 - (49%) Gaps:16/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66
            :.:||..:...:.|.:|    .|..:|:|:||........|:|.:|.........||||::..:|
Human     1 MFLLLTALQVLAIAMTQ----SQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQW 61

  Fly    67 IITAAHCTRGRQATAFRVLTGTQDLH--QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIV 129
            :||||||.|    ...:|..|..:|.  :...:.....|.|.|.||..|.:.||:.||.|.:...
Human    62 VITAAHCGR----PILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPAR 122

  Fly   130 FDNATQPVELDHEALVPGSRLLLTGWGTLSLG-GDVPARLQSLEVNYVPFEQCRAAHDNSTRVDI 193
            ...|.:|:|:......||:...::||||:|.. ...||.||.:.:|..|.|.|:.|:..:  :..
Human   123 IGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRT--ITP 185

  Fly   194 GHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLP-CA-KGYPDAHASISYYHDFI 249
            |.||. ....|:.:|.||||||||..|:|..||:||:. || .|||..:.::..|..:|
Human   186 GMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/225 (34%)
Tryp_SPc 30..252 CDD:238113 77/226 (34%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 77/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12540
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.