DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG9737

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:126/284 - (44%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRG-----RQAT------A 81
            |||.|||.|.....|: ::|....|..:.|.||:||:|.|:|||||.:|     ||..      .
  Fly   148 NRIYGGEIAELDEFPW-LALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGE 211

  Fly    82 FRVLTGTQDLHQNG-------------SKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNA 133
            |.|.|....:.:..             .|.:......|.|||   || ||||::.|...:.|.:.
  Fly   212 FNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNY---KY-NDIAIIRLKHPVSFTHF 272

  Fly   134 TQPVELDHEA----LVPGSRLLLTGWGTLSLGGDV------PARLQSLEVNYVPFEQC-RAAHDN 187
            ..|:.|.:::    |..|....::|||...|....      |.:|: |.:.||..|.| :.....
  Fly   273 VMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLK-LRIPYVSNENCTKILEGF 336

  Fly   188 STRVDIGHVCTFNDKGRGACHGDSGGPLVH----NGKLVA--LVNWGL-PCA-KGYPDAHASISY 244
            ..|:....:|...:..:..|.|||||||::    :.:.||  :|::|. .|. .|.|..:.:::.
  Fly   337 GVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAE 401

  Fly   245 YHDFIRTHLSLSKTDSSEDIEEEM 268
            |.|:|.:.:...|  .|:..:::|
  Fly   402 YTDWIDSVVQQRK--KSQQTQDKM 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/262 (28%)
Tryp_SPc 30..252 CDD:238113 74/264 (28%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/262 (28%)
Tryp_SPc 150..409 CDD:238113 74/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.