DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:247 Identity:60/247 - (24%)
Similarity:106/247 - (42%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KNRIVGGEEAAAGLAPYQISLQGIGSGAHS----CGGAIIDERWIITAAHCTRGRQATAFRVLTG 87
            :.||..|..|:.|..||   :.|:...::.    |||:||...|::||||||.|....:      
  Fly    38 EGRITNGNLASEGQVPY---IVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEAS------ 93

  Fly    88 TQDLHQNGSKYYYP--------DRIVEHSNYAPRKYRNDIALL---HLNESIVFDNATQPVEL-- 139
               |:.....|..|        :..:.:.:|....:  |:||:   |::    |.:....:||  
  Fly    94 ---LYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDH--DLALIKTPHVD----FYSLVNKIELPS 149

  Fly   140 --DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDK 202
              |.......:.:...|||.:..|.:|...|:.:::..:...:|:|.:...|..: ..:|.....
  Fly   150 LDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASE-NTICVETPD 213

  Fly   203 GRGACHGDSGGPLV--HNGKLVALVNW--GLPCAKGYPDAHASISYYHDFIR 250
            |:..|.||||||||  ...||:.:.::  ...|..|.|.....::.|.::|:
  Fly   214 GKATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 59/242 (24%)
Tryp_SPc 30..252 CDD:238113 59/244 (24%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 59/242 (24%)
Tryp_SPc 41..266 CDD:238113 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436845
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.