DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG11843

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:119/283 - (42%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLVLFTSSAASQIL-----YPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHS-----CGG 59
            |||    .:|..|:|:     |.|     .||||..|.....|:...| |......|     |||
  Fly    47 LLP----GASIESRIIDNCRSYTP-----LIVGGHPAQPREFPHMARL-GRRPDPSSRADWFCGG 101

  Fly    60 AIIDERWIITAAHCTRGRQATAFRVLTGTQD---LHQNGS-KYYYPDRIVEHSNYAPRKYRNDIA 120
            .:|.||:::|||||....:.....|..|..|   |.::.: :.|.....:.|..|...::.:||.
  Fly   102 VLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIG 166

  Fly   121 LLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEV----NYV----- 176
            |:.|.|::|||....|..|..:........:..|||:..|.....|:|..:::    |:|     
  Fly   167 LVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLL 231

  Fly   177 --PFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGK-------LVALVNWGLPC- 231
              ..|:.....|.:.:     :|..::..:..|:|||||||:...:       :|.:.:.||.| 
  Fly   232 TRQVEEFPRGFDGNNQ-----LCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG 291

  Fly   232 AKGYPDAHASISYYHDFIRTHLS 254
            :.|.|..:..:..|..:|...|:
  Fly   292 SPGIPGIYTRVYPYLGWIARTLA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 63/247 (26%)
Tryp_SPc 30..252 CDD:238113 64/249 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 64/249 (26%)
Tryp_SPc 68..309 CDD:214473 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.