DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG11841

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:221 Identity:46/221 - (20%)
Similarity:91/221 - (41%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPD----RIVEHSNYAPRKYRN 117
            |||.:|..|.::|||||..........|..|..:...:.......|    .:..|..:...:..|
  Fly   102 CGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYN 166

  Fly   118 DIALLHLNESIVFDNATQPVEL------DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYV 176
            ||.::.|:..:.|:....|..|      .||:.:      ..|||..........:|..:::...
  Fly   167 DIGIVQLDREVKFNRYKHPACLPFDDGEQHESFI------AIGWGQKKFAQKESKKLLKVQLQGY 225

  Fly   177 PFEQCRAAHDNSTRVDIGH-----VCTFNDKGRGACHGDSGGPLVHNGK-------LVALVNWGL 229
            . ::|.::.|.:..:..|:     :|..:...:..|:||||||::...|       ::.:.:.|:
  Fly   226 K-DRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGI 289

  Fly   230 PCA-KGYPDAHASISYYHDFIRTHLS 254
            .|: ...|.|:..:.|:.::|:..|:
  Fly   290 TCSTPDIPSAYTRVHYFLNWIKGELA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 44/214 (21%)
Tryp_SPc 30..252 CDD:238113 45/217 (21%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 44/215 (20%)
Tryp_SPc 72..310 CDD:214473 44/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.