DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG4815

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:65/271 - (23%)
Similarity:101/271 - (37%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLVLFTSSAASQILYPPQYTKN---RIVGGEEAAAGLAPYQISLQGIGSGAHS-----CGGAI 61
            |:.|:|..:|..::.....::|..   ||..|.:....      ||.|:|....:     |...:
  Fly     7 LVRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKTTVE------SLGGVGIQLFNGRKLVCSATL 65

  Fly    62 IDERWIITAAHCTRGRQATAFRVLTGTQ---DLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLH 123
            :..|.|:|||||......:.|.|:.|..   ..|.|........|:..|..||..|:..|:|:. 
  Fly    66 LTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVA- 129

  Fly   124 LNESIVFDNATQPV--------ELDHEALVPGSRLLLTGWGTLSLGGDV-----PARLQSLEVNY 175
                    ....|:        :|....|.|..:|:..|||   ..|.|     ....:|::|..
  Fly   130 --------KTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWG---FEGGVWDESRKKTFRSMKVGI 183

  Fly   176 VPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKG-YPDAH 239
            |....|....|.....:|  :|......:..|.|||||||:...::..:..|...|... .||.:
  Fly   184 VSKRDCEKQLDRKMPPNI--ICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWTFKCGNNEKPDVY 246

  Fly   240 ASISYYHDFIR 250
            ..:.||..||:
  Fly   247 MGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 58/241 (24%)
Tryp_SPc 30..252 CDD:238113 59/243 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 54/223 (24%)
Trypsin 49..256 CDD:278516 52/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.