DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG10232

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:290 Identity:66/290 - (22%)
Similarity:108/290 - (37%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISL----QGIGSGAHSCGGAIIDERWIIT 69
            ||.||...:    ||.|   |:..|..|.....|:...|    :.:.:..::|.|::|::|:::|
  Fly   243 VLPTSCGQA----PPLY---RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLT 300

  Fly    70 AAHCT-----RGRQATAFRVLTGTQDLHQN----------------GSKYYYPDRIVEHSNYAPR 113
            ||||.     ........||..|..|:..|                |.:|:.    |....:...
  Fly   301 AAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFN----VHEQYFNTS 361

  Fly   114 KYRNDIALLHLNESIVFDNATQPVELDHEAL---VP-------GSRLLLTGWGTLSLGGDVPARL 168
            ::.:||||:.|.         .||...||.|   ||       ...|.:.|||...     ....
  Fly   362 RFESDIALVRLQ---------TPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYTK-----NREY 412

  Fly   169 QSLEVNYVPFEQCRAAHDN-STRVDIGHVCTFNDKGRGACHGDSGGPL---VHNG-----KLVAL 224
            ..:.::...:|......|. |...:...:|....:|..:|.|||||||   ::|.     .|..:
  Fly   413 SQVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGI 477

  Fly   225 VNWGLP-CAKGYPDAHASISYYHDFIRTHL 253
            |::|.. |....|..:.....:..:|:.:|
  Fly   478 VSYGSENCGDRKPGVYTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 57/264 (22%)
Tryp_SPc 30..252 CDD:238113 57/266 (21%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 57/263 (22%)
Tryp_SPc 260..503 CDD:214473 56/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.