DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG16710

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:284 Identity:80/284 - (28%)
Similarity:118/284 - (41%) Gaps:66/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SQILYP--PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAH------------SCGGAIIDERWI 67
            :||..|  |.|   ||.||||.    .|.::....:...||            .|.|::|..|::
  Fly    94 TQICGPIMPAY---RIFGGEET----QPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYV 151

  Fly    68 ITAAHCTRGRQATAFRVLTGTQDL--------HQNGSKYYYPDRI-------VEHSNY---APRK 114
            :|||||.|.......||..|..::        |.||.::..|:.:       ::|.:|   ..|.
  Fly   152 LTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERP 216

  Fly   115 YRNDIALLHLNESIVFDNATQP--VELDHEALVP---GSRLLLTGWGTLSLGGDVPARLQSLEVN 174
            | ||||||.|...:.:....:|  |:||:....|   ..:|.:.|||.....|.....||:. ||
  Fly   217 Y-NDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAY-VN 279

  Fly   175 YVPFEQCRAAH-----DNSTRVDIGHVCTFNDKGRGACHGDSGGPL---VHNGK-----LVALVN 226
            ....::|..:.     |..|     |:|..|..|...|.|||||||   :..|.     |..:.:
  Fly   280 GRNADECSLSEPSLGLDKET-----HICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITS 339

  Fly   227 WGL-PCAKGYPDAHASISYYHDFI 249
            :|. .|..| |.|:...|.:.::|
  Fly   340 YGYSQCGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/268 (28%)
Tryp_SPc 30..252 CDD:238113 74/269 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 74/268 (28%)
Tryp_SPc 106..362 CDD:238113 73/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.