DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG31199

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:142 Identity:36/142 - (25%)
Similarity:54/142 - (38%) Gaps:38/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HSCGGAIIDERWIITAAHC--TRGRQATAFRVLTGTQDLHQN----GSKYYYPD----------- 102
            :.|.|.::.:|.::..|||  .....|.||.|..|   :|..    |.:....|           
  Fly    69 NGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLG---VHNKSAPVGVRVCETDGYCVRPSQEIK 130

  Fly   103 --RIVEHSNYAPRKYRNDIALLHL-NESIVFDN----ATQPVELDHEAL------VPGSRLL--- 151
              .|..|.:|..|..:|.:|:|.| .::.::.|    ...|..|.:|.|      |.|.|:.   
  Fly   131 LAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDF 195

  Fly   152 -LTGW-GTLSLG 161
             |..| .|||.|
  Fly   196 RLKTWVNTLSRG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 36/142 (25%)
Tryp_SPc 30..252 CDD:238113 36/142 (25%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.