DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG31219

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:105/274 - (38%) Gaps:67/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHS----CGGAIIDERWIITAAHCTRG--RQATAFRVLTG 87
            |:|||.||.....|:...|..:.:....    |.|::|:.|:::|:|||..|  |..:...|..|
  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152

  Fly    88 TQDLHQNGSKYYYPD------------------RIVEHSNYAPRKYRN---DIALLHLNESIVFD 131
            ..|:..:.:  |.||                  :|:.|..::....||   |||||.|...:.:.
  Fly   153 EHDITYDPA--YNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYR 215

  Fly   132 NATQPVELDHEALVPGSRLLLTGWGTLSLG--------GDVPAR---LQSLEVNYVPFEQ----C 181
            ....|:.:........|:|.:.|||..:.|        |.:..|   :.:|...|:...|    |
  Fly   216 TGIMPICIPKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQIC 280

  Fly   182 RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPL---VHNGK--LVALVNWGLP-CAK-GYPDAH 239
            ...:|                |...|.|||||||   :.|..  |..:..:|.. |.: |.|..:
  Fly   281 AGGYD----------------GVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIY 329

  Fly   240 ASISYYHDFIRTHL 253
            ...|.:..:|:..|
  Fly   330 TRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 64/268 (24%)
Tryp_SPc 30..252 CDD:238113 64/270 (24%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 64/268 (24%)
Tryp_SPc 90..342 CDD:238113 64/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.