DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG4053

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:227 Identity:108/227 - (47%)
Similarity:139/227 - (61%) Gaps:4/227 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH 92
            ||||||:||..|:||||:|:|.|.. .|.|.|.|::|:||:||.||.........|::.||.|..
  Fly    33 NRIVGGQEAEDGVAPYQVSIQTIWK-THICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRL 96

  Fly    93 QNGSKYYYPDRIVEHSNY-APRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWG 156
            :.| :..:||..:.|..| .|..|.|||||:|:||||:|::.||.|||..|....||.:.|||||
  Fly    97 EPG-QTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWG 160

  Fly   157 TLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKL 221
            ...........||:|.:..:..|:||...|....:||||:|||..:|.|||.|||||||:..|||
  Fly   161 APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKL 225

  Fly   222 VALVNWGLPCAKGYPDAHASISYYHDFI-RTH 252
            |.|||||..|..|.||.:|:..||.|:| |||
  Fly   226 VGLVNWGRACGVGMPDMYANTVYYQDWIRRTH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 103/220 (47%)
Tryp_SPc 30..252 CDD:238113 104/223 (47%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 103/220 (47%)
Tryp_SPc 35..256 CDD:238113 103/222 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5706
55.030

Return to query results.
Submit another query.