DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG17475

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:228 Identity:108/228 - (47%)
Similarity:144/228 - (63%) Gaps:2/228 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL 91
            :||::.||:...|.|.|||||||: .|.|.|||.|||||.::|||||..|...|..||:|||.:.
  Fly    47 QNRVINGEDVQLGEAKYQISLQGM-YGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEY 110

  Fly    92 HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWG 156
            .:..:.|:..:..: |.||....|.|||||:.||::|.|:..|||.||....:..|::|||||||
  Fly   111 EKPDAVYFVEEHWI-HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWG 174

  Fly   157 TLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKL 221
            :..|.||.|..||...:.:|.:..|:...:|.......|:||....|:|||||||||||.|||.|
  Fly   175 STELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVL 239

  Fly   222 VALVNWGLPCAKGYPDAHASISYYHDFIRTHLS 254
            ..|||||.|||.|.||:||::.||.::||:.:|
  Fly   240 YGLVNWGYPCALGVPDSHANVYYYLEWIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 104/219 (47%)
Tryp_SPc 30..252 CDD:238113 105/221 (48%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 104/219 (47%)
Tryp_SPc 50..269 CDD:238113 104/220 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.