DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG17477

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:228 Identity:108/228 - (47%)
Similarity:144/228 - (63%) Gaps:5/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQN 94
            ||||:.||.|.||||:|||.: .|:|.||||||.:||||||.||.:|...:..:|.|||....:.
  Fly    27 IVGGQNAAEGDAPYQVSLQTL-LGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEP 90

  Fly    95 GSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPG-SRLLLTGWGTL 158
            |: .||||.|..|.||...||:|||.||||||||.|:..||.|||.......| |.|:.||||:.
  Fly    91 GA-VYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQ 154

  Fly   159 SLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIG--HVCTFNDKGRGACHGDSGGPLVHNGKL 221
            |..|.:|::||.::..::....|.:.......:::|  |:|.:.....|||||||||||||.|.|
  Fly   155 SAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTL 219

  Fly   222 VALVNWGLPCAKGYPDAHASISYYHDFIRTHLS 254
            |.::|:.:|||:|.||...:|.||.|::|..:|
  Fly   220 VGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 106/221 (48%)
Tryp_SPc 30..252 CDD:238113 107/224 (48%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 107/224 (48%)
Tryp_SPc 27..246 CDD:214473 105/220 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.