DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG31326

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:252 Identity:55/252 - (21%)
Similarity:105/252 - (41%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVGGEEAAAGLAPYQISL---QGIGSGAHSCGGAIIDERWIITAAHCTR--GRQATAFRVLT--- 86
            |..|:....|..|:.:::   :.....|..|||.:|....:::||||.|  ||...|.|:..   
  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLG 338

  Fly    87 -GTQDLHQNGSKYYYPDRIVEHSNYAPRKYRN-DIALLHLNESIVFDNATQPVEL----DHEALV 145
             .|..:|.:| ::....:::.|.|:..:::.. |:||:.|:|.:.:.:...|:.|    :...|.
  Fly   339 RNTLAIHSDG-EFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLP 402

  Fly   146 PGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHV-------CTFNDKG 203
            .|.:..:.|||....|.......:..::|.|....|        .:::.||       |. ...|
  Fly   403 QGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANC--------ALELPHVLVQPSSLCA-KKTG 458

  Fly   204 RGACHGDSGGPLVHNGK----LVALVNWGL------PCAKGYPDAHASISYYHDFIR 250
            .|.|..|.||||:...:    |..:::.|:      .|....|.....::.:.:::|
  Fly   459 AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 54/249 (22%)
Tryp_SPc 30..252 CDD:238113 55/252 (22%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 54/249 (22%)
Tryp_SPc 277..514 CDD:214473 53/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.