DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG9649

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:202 Identity:55/202 - (27%)
Similarity:91/202 - (45%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVGGEEAAAGLAPYQISL-QGIGSGAH-SCGGAIIDERWIITAAHCTR--GRQATAFRVLT---- 86
            |..|.|...|..|:..:| :.:|...: .|||.:|..|.:|:||||.|  .|.....|.:.    
  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGR 321

  Fly    87 GTQDLHQNGSKYYYPDRIVEHSNYAPRKYRN-DIALLHLNESIVFDNATQPVELDHE----ALVP 146
            .:.||..:|:..... |::.|..|.|..|.: |:|||.|:..:...:..:|:.|.:|    .|..
  Fly   322 NSLDLFSSGATLGVA-RLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPS 385

  Fly   147 GSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRA--AHDNSTRVDIGHVCTFNDKGRGACHG 209
            |.:..:.|||....|.......:..:.:.:...:||.  :.:|:..:....:|..|.:..|.|.|
  Fly   386 GHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSG 450

  Fly   210 DSGGPLV 216
            ||||.|:
  Fly   451 DSGGGLM 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 55/202 (27%)
Tryp_SPc 30..252 CDD:238113 55/202 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 55/202 (27%)
Tryp_SPc 259..497 CDD:214473 54/200 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.