DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG13318

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:117/263 - (44%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVL 85
            :||.........| :|:.|..|:|.:|. ..:..:..|||:|..:.::||||.......|.|:|.
  Fly   155 FPPPPGSTTAAPG-QASFGAYPWQAALL-TTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVR 217

  Fly    86 TGTQDLHQNG----SKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALV- 145
            .|..|.....    ::..|...:..:.::.|...:||:|:|.|         :.||.|..::.| 
  Fly   218 LGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKL---------STPVSLTSKSTVG 273

  Fly   146 ---------PGSRLLLTGWGTLSLG--GDVPARLQSLEVNYVPFEQCRAAHDNSTRV-------D 192
                     .|.|..:.|||....|  |...|..:.::|..:|...|:||. .:||:       .
  Fly   274 TVCLPTTSFVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAAL-QATRLGSSFVLSP 337

  Fly   193 IGHVCTFNDKGRGACHGDSGGPLV--HNG--KLVALVNWGLPCAK-GYPDAHASISYYHDFIRTH 252
            ...:|...:.|:.||.||.|.|||  .||  .:|.||.||:.||: |.|..:.::..|..:|:|.
  Fly   338 TSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTT 402

  Fly   253 LSL 255
            |:|
  Fly   403 LTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/247 (27%)
Tryp_SPc 30..252 CDD:238113 68/249 (27%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 67/243 (28%)
Tryp_SPc 169..399 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.