DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Prss57

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038935644.1 Gene:Prss57 / 408241 RGDID:1303330 Length:290 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:122/275 - (44%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLFTSSAASQILYPPQYTK------------NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGA 60
            |.|..::|.:|:|:.|....            :.||||.|......||..|:.  ..|.|.|||.
  Rat    12 LTLVVATALTQLLWLPGENSTWPLDPTQGCCGSHIVGGHEVKPHARPYMASVN--FEGHHHCGGF 74

  Fly    61 IIDERWIITAAHCTRGRQATAFRVLTGTQDL--HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLH 123
            :....|:::||||...|..:...|:.|...|  .:...:.:....:|.|.::.|....|||.||.
  Rat    75 LFHAHWVLSAAHCFSDRDPSTGLVVLGAHALLTPEPTQQVFGIAAVVSHPDFEPTTQANDICLLR 139

  Fly   124 LNESIVFDNATQPVELDHEALVP---GSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAH 185
            ||.|.|...|.:.:.|......|   |:|..::|||::|...:.|..|..:||..:....|.::.
  Rat   140 LNGSAVLGPAVRLLRLPRRGAKPPVAGTRCRVSGWGSVSDFEEPPPGLMEVEVRILDLSVCNSSW 204

  Fly   186 DNSTRVDIGHVCTFND--KGRGACHGDSGGPLVHNGKLVALVNW-GLPCA-KGYPDAHASISYYH 246
            ..  ::....:||.:.  :.||.|..|||||||...:...||:: ||.|. ...||.:..:|.:.
  Rat   205 QG--QLSPAMLCTHSGDRRRRGFCSADSGGPLVCGNRAHGLVSFSGLWCGDPKTPDVYTQVSAFV 267

  Fly   247 DFIRTHLSLSKTDSS 261
            .:|...:..|.|..|
  Rat   268 SWIWDVVRASPTPGS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/228 (30%)
Tryp_SPc 30..252 CDD:238113 69/230 (30%)
Prss57XP_038935644.1 Tryp_SPc 46..270 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.