DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Klk4

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:248 Identity:71/248 - (28%)
Similarity:121/248 - (48%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRG 76
            |.|:||.|       .:||:.|::......|:|.:|.. ...|..|.|.::..:|:::||||.:.
  Rat    21 TGSSASSI-------SSRIIQGQDCLPHSQPWQAALFS-EDNAFFCSGVLVHPQWVLSAAHCIQD 77

  Fly    77 RQATAFRV--LTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVEL 139
            .......:  |.|:|   :.||:.......::|.||....:.||:.|:.||||::..|..:.:.:
  Rat    78 SYTVGLGLHNLEGSQ---EPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPV 139

  Fly   140 DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKG- 203
            ..:...||...|::|||.|. .|.:|:.||.:.::....|.||..:|     .:.|:..|...| 
  Rat   140 ASQCPTPGDTCLVSGWGRLK-NGKLPSLLQCVNLSVASEETCRLLYD-----PVYHLSMFCAGGG 198

  Fly   204 ---RGACHGDSGGPLVHNGKLVALVNWGL-PCAK-GYPDAHASISYYHDFIRT 251
               :..|:||||||:|.|..|..||:.|. .|.: |.|..:.::..:.::|.|
  Rat   199 PDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 64/227 (28%)
Tryp_SPc 30..252 CDD:238113 65/230 (28%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.