DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG14088

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:294 Identity:68/294 - (23%)
Similarity:109/294 - (37%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSG-AHSCG-----G 59
            ::.:|..|::|.|...|     .|:..| |.|  |...||:|   .:.|..:. .|..|     |
  Fly     7 IVAVLTSLLIFLSGTGS-----AQFLGN-ICG--ERRDGLSP---DIVGPWTAILHHFGRIVGVG 60

  Fly    60 AIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIV----EHSNYAPRKYRNDIA 120
            .:|.||:|:|..||  |......|...|  :..:.||: ...|.||    .::|:.|....|::.
  Fly    61 TLIHERFILTDVHC--GDSIGVIRARLG--EYGRIGSE-LAEDHIVAAFFSNANFNPETQANNMG 120

  Fly   121 LLHLNESIVFDNATQPV-------------ELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLE 172
            |:.|..::|:.....||             |||:..            ||.....|....|:|..
  Fly   121 LMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN------------GTTWKNSDKSPMLRSKT 173

  Fly   173 VNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVA---LVNWGLPCAKG 234
            |..:| :.|       .::|.|..|. ..|...:|...||..|......:.   .|.:|:  |..
  Fly   174 VIRMP-QAC-------GKLDHGQFCA-GHKDLDSCDEPSGAALTREIDYIGPNRTVLFGI--ANS 227

  Fly   235 YPDAHASISYYHDFIRTHLSLSKTDSSEDIEEEM 268
            .....::...|.|.::.|..:|....|.:..:.|
  Fly   228 VEVKCSNSRTYTDVVQLHQWISMVIYSSNTNDGM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 57/245 (23%)
Tryp_SPc 30..252 CDD:238113 57/247 (23%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 53/236 (22%)
Tryp_SPc 42..248 CDD:214473 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.