DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and PRSS57

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:253 Identity:72/253 - (28%)
Similarity:111/253 - (43%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAA 71
            ||:...::....:..|......:|:||.|......||..|::  ..|.|.|||.::..||:::||
Human    11 PLLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVR--FGGQHHCGGFLLRARWVVSAA 73

  Fly    72 HCTRGRQATAFRVLTGTQDLH--QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNAT 134
            ||...|......|:.|...|.  :...:.:..|.:..|.:|.|..:.|||.||.||.|.|...|.
Human    74 HCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAV 138

  Fly   135 ---QPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGH- 195
               :|..........|:|..:.|||.:|...::|..|...:|..:..:.|.::..       || 
Human   139 GLLRPPGRRARPPTAGTRCRVAGWGFVSDFEELPPGLMEAKVRVLDPDVCNSSWK-------GHL 196

  Fly   196 ----VCTFNDKG--RGACHGDSGGPLVHNGKLVALVNW-GLPCA-KGYPDAHASISYY 245
                :||.:...  ||.|..|||||||...:...||:: ||.|. ...||.:..:|.:
Human   197 TLTMLCTRSGDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/231 (30%)
Tryp_SPc 30..252 CDD:238113 69/230 (30%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 69/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.