DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG11529

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:121/273 - (44%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILYPPQYTKNRIVGGEEAAAGLA---PYQISLQG--IGSGAHSCGGAIIDERWIITAAHCTRGRQ 78
            :::.|..|.:..||  ::..|..   |||:.|.|  :......|||.::|:|||:||.|||.|  
  Fly    18 MMWKPTPTDSYAVG--QSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMG-- 78

  Fly    79 ATAFRVLTGT---QDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELD 140
            .|.:.|..||   :|...:|......::.:.|..:.|....|||||:.|.:.:.|....||..|.
  Fly    79 VTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLP 143

  Fly   141 ----HEALVPGSRLLLTGWGTL--SLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTF 199
                |:... |..::.:|||.:  ....|   .:|..|:..:...:|...:|..|.   |.:|..
  Fly   144 SRYRHDQFA-GMSVVASGWGAMVEMTNSD---SMQYTELKVISNAECAQEYDVVTS---GVICAK 201

  Fly   200 NDKGRGACHGDSGGPLVHNGK--LVALVNWGLP---CAKGYPDAHASISYYHDFIRTHLSLSKTD 259
            ..|....|.||||||||....  :|.:.::| |   |....|.....:::|.|:|.     ||..
  Fly   202 GLKDETVCTGDSGGPLVLKDTQIVVGITSFG-PADGCETNIPGGFTRVTHYLDWIE-----SKIG 260

  Fly   260 SSEDIEEEMIALQ 272
            |...:.::.:..|
  Fly   261 SHGQVHQQYLRPQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/238 (29%)
Tryp_SPc 30..252 CDD:238113 70/240 (29%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 67/235 (29%)
Tryp_SPc 37..255 CDD:214473 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.