DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG18179

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:286 Identity:81/286 - (28%)
Similarity:128/286 - (44%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPL-----VLFTSSAASQILYPPQYT-----KNRIVGGEEAAAGLAPYQISL--QGIGSG 53
            |.|.||.|     |:..|...::....||.|     :.|||.|..|..|.|||.:.|  :..||.
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSN 65

  Fly    54 AHSCG-GAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYY---------PDRIVEHS 108
            :.:.| |.||...||:|||||          :.|...::|. ||.:.:         .|..:.|.
  Fly    66 SAAVGAGTIIASDWILTAAHC----------LTTDYVEIHY-GSNWGWNGAFRQSVRRDNFISHP 119

  Fly   109 NYAPRKYRNDIALLHLNESIVFDNATQPVEL-----DHEALVPGSRLLLTGWGTLSLGGDVPARL 168
            |: |.:...||.|:. ..|:.|.:....|.|     :.:..| .:..:..|||.:. .|::...|
  Fly   120 NW-PAEGGRDIGLIR-TPSVGFTDLINKVALPSFSEESDRFV-DTWCVACGWGGMD-NGNLADWL 180

  Fly   169 QSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV--HNGKLVALVNWG-LP 230
            |.::|..:...:|..::......|   :||....|:.:|.||||||||  .|.:||.::.:| :.
  Fly   181 QCMDVQIISNSECEQSYGTVASTD---MCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSVD 242

  Fly   231 CAKGYPDAHASISYYHDFIRTHLSLS 256
            |..| |..:..::.|..:||.:..:|
  Fly   243 CHSG-PSGYTRVTDYLGWIRDNTGIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/239 (28%)
Tryp_SPc 30..252 CDD:238113 69/241 (29%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/239 (28%)
Tryp_SPc 40..263 CDD:238113 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436797
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.