DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:279 Identity:84/279 - (30%)
Similarity:125/279 - (44%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTK-----NRIVGGEEAAAGLAPYQISLQGIG-SGAHSCGG 59
            :.|.:|.|.:.::||...:::|...:|     .||..|..|..|.|||.:   |:| ||...|||
  Fly     3 VFLTILALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTV---GLGFSGGWWCGG 64

  Fly    60 AIIDERWIITAAHCTRGRQATAF---RVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIAL 121
            :||...|::||.||..|...|.:   ...|..|..|..||     ...:.|.:       .||||
  Fly    65 SIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQFTHWVGS-----GNFITHGS-------ADIAL 117

  Fly   122 LHLNESIVFDNATQPVELDHEALVPGSR----------LLLTGWGTLSLGGDVPARLQSLEVNYV 176
            :.: ..:.|.:....|||      |...          .:..|||....|..:|..||.:::..:
  Fly   118 IRI-PHVDFWHMVNKVEL------PSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQII 175

  Fly   177 PFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNW--GLPCAKGYPD 237
            ...:|.:.:...| |....:|.....|:|.|.|||||||| |:| |||.:.||  |..|..|:|.
  Fly   176 HNSECASYYGTGT-VGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPA 239

  Fly   238 AHASISYYHDFIRTHLSLS 256
            ....::|:.|:||.|..::
  Fly   240 GFQRVTYHLDWIRDHTGIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/237 (31%)
Tryp_SPc 30..252 CDD:238113 75/239 (31%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 74/237 (31%)
Tryp_SPc 37..254 CDD:238113 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436779
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.