DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG33460

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:275 Identity:66/275 - (24%)
Similarity:108/275 - (39%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66
            ||....||:::.|.::..|| .|....|    ||.:..|.|:...|.  ..|:..|.|.:|.:.:
  Fly     9 LLASYMLVIYSDSVSANYLY-EQCGLMR----EEFSTSLGPWTALLH--TDGSIFCAGTLITDVF 66

  Fly    67 IITAAHCTRGRQATAFRVLTGTQDLHQNG------SKYYYPDRIVEHSNYAPRKYRNDIALLHLN 125
            |:|||.|.|   ..|.:|..|....:.|.      ..|:...|:..:.:.|     |:|.||.|.
  Fly    67 ILTAASCIR---PNAVKVRLGEFGRYPNELPEDHLVHYFLMYRLFNNESLA-----NNIGLLKLT 123

  Fly   126 ESIVFDNATQPVELDHEALVPGSRLLLT------GW---GTLSLGGDV-PARLQS---LEVNYVP 177
            :.:...:...||.:   .|.|.::.|.|      .|   ..:||..:: |..:||   :..|...
  Fly   124 KRVQITDYIMPVCI---VLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDL 185

  Fly   178 FEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKL----------VALVNWGLPC- 231
            :.|..|.|..:.|               :|.|.:|..|:.|.:.          :|.|| .:.| 
  Fly   186 YTQFCAGHQGNLR---------------SCDGLTGSALIQNSRYMNKYRHIQFGIATVN-DMDCE 234

  Fly   232 -AKGYPDAHASISYY 245
             ::||.|.   :.:|
  Fly   235 ESQGYTDV---LKFY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 58/248 (23%)
Tryp_SPc 30..252 CDD:238113 57/247 (23%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 54/235 (23%)
Tryp_SPc 44..249 CDD:214473 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.