DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG16998

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:173 Identity:40/173 - (23%)
Similarity:68/173 - (39%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GFQIKKLFLRNNGLRSFHP---NTFTGNLENSLEELEIRGNYIDGIPQSGVSILKQLKILSLPDN 142
            |....|:.|.|...:..||   :..:..||:|.:|..|            .|.:::|:.....:.
  Fly   371 GISSWKVKLENLCFKHLHPDQHHEMSDMLEDSFDEAMI------------TSAIEKLEQALKKEG 423

  Fly   143 LIEYVQDNAFLSYHS-RDSLLKLDLSANNLTAIHPTGLLGLEN----LSQLSLDKNLLSEIPSQA 202
            :..:|......|.:| ...:||..|:.:.:..||...|: ::|    ...|.:...|.||:|.:.
  Fly   424 ISYHVVSGRHKSLYSIYCKMLKKKLTMDEIHDIHGLRLI-VDNEKDCYKALGVVHKLWSEVPGKL 487

  Fly   203 LENI--PSLEDLSLGVNRIHTISRNSLPLPNLKSLSLEVNQIR 243
            .:.|  |...    |...:||:......:|      ||| |||
  Fly   488 KDYISHPKFN----GYQSLHTVVMGDGTIP------LEV-QIR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 40/173 (23%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.