DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG10469

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:126/282 - (44%) Gaps:54/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISL----QGIGSGAHSCGGAI 61
            |:|.|:.:|.|:      :::..:....||:.|..|.|...|||:.|    :|.....:.|||.|
  Fly     1 MILQLVLIVQFS------LVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTI 59

  Fly    62 IDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIV-------EHSNYAPRKYRNDI 119
            :..|||||||||.:..::..::||     :|....|.:....||       .|..:..:...|||
  Fly    60 LSNRWIITAAHCLQDPKSNLWKVL-----IHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDI 119

  Fly   120 ALLHLNESIVFDNATQPVEL-DHEALVPGSRLLLTGWG--TLSLGGDVPARLQSLEVNYVPFEQC 181
            ||:.|.:.:.|:...||.:| ..:....|.:.:::|||  |..|...|   ||.:....:..::|
  Fly   120 ALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAIISGWGLTTKQLPSQV---LQYIRAPIISNKEC 181

  Fly   182 -------------RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNGK--LVALVNWGL- 229
                         :..|:       |.:|..:.||. .|.||||||:| .:|.  ||.:|:.|. 
  Fly   182 ERQWNKQLGGKSKKVVHN-------GFICIDSKKGL-PCRGDSGGPMVLDDGSRTLVGIVSHGFD 238

  Fly   230 -PCAKGYPDAHASISYYHDFIR 250
             .|....||....:|.|..:|:
  Fly   239 GECKLKLPDVSTRVSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 73/251 (29%)
Tryp_SPc 30..252 CDD:238113 73/253 (29%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 73/251 (29%)
Tryp_SPc 24..260 CDD:238113 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436905
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.