DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG10472

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:108/243 - (44%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQIS-LQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQD-- 90
            ||.||:.|.....|||:. |..|..||..|||.||.:|||||||||| ....|...|..|..|  
  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCT-DSLTTGVDVYLGAHDRT 109

  Fly    91 -LHQNGSKYYYPD--RIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVEL----DHEALVPGS 148
             ..:.|.:..:.:  .::.|.::......|||:|:.|...|.|:...||.:|    |..:...|.
  Fly   110 NAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGE 174

  Fly   149 RLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNS-------TRVDIGHVCTFNDKGRGA 206
            ..:.:|||.:|  .........|:...||.      .:||       ..|...::|.....|...
  Fly   175 NAIASGWGKIS--DSATGATDILQYATVPI------MNNSGCSPWYFGLVAASNICIKTTGGIST 231

  Fly   207 CHGDSGGPLV---HNGKLVALVNWG--LPCAKGYPDAHASISYYHDFI 249
            |:||||||||   .:..|:...::|  |.|..|:|.....|:||.|:|
  Fly   232 CNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/241 (32%)
Tryp_SPc 30..252 CDD:238113 76/242 (31%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 76/241 (32%)
Tryp_SPc 47..282 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436875
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.