DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:123/280 - (43%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLVLFTSSAASQILYPPQYTKN---------RIVGGEEAAAGLAPYQISLQ---GIGSGAHSC 57
            :|.::||::.|....|..|...|:         ||..|..|..|..||.::|:   |.|.|.: |
  Fly     3 VLGVLLFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGGWY-C 66

  Fly    58 GGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALL 122
            ||:||...|::||||||.|  |:...:..|.....|           .:.::|......|||||:
  Fly    67 GGSIIGHEWVLTAAHCTYG--ASYVTISYGAVWRQQ-----------PQFTHYDTGNLHNDIALI 118

  Fly   123 HLNESIVFDNATQPVEL----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRA 183
            . ...:.|.:....|||    |......|...||:|||:.|....:...|..:::.         
  Fly   119 R-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQ--------- 173

  Fly   184 AHDNSTRVDI--------GHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNWG--LPCAKGYP 236
            ..|||..:|.        .|:|....:.:|:|.|||||||| |:| :.|.:|::|  ..|....|
  Fly   174 ISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSP 238

  Fly   237 DAHASISYYHDFIRTHLSLS 256
            .....::.|.|:||.|..:|
  Fly   239 KGLTRVTGYLDWIRDHTGIS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/238 (30%)
Tryp_SPc 30..252 CDD:238113 72/240 (30%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 71/238 (30%)
Tryp_SPc 37..254 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436755
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.