DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:122/278 - (43%) Gaps:35/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYPPQYTKN-----------RIVGGEEAAAGLAPYQISLQGIGSGAHS 56
            ||:|.|.:    |||....|....::           ||.||..||.|..|||:.|....|...|
  Fly     4 LIILALAV----AASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSS 64

  Fly    57 --CGGAIIDERWIITAAHCTRGRQATAF----RVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKY 115
              |||::|...|::||||||.|.|:...    .|.|..:..|...|     ..|:.||.:.....
  Fly    65 AWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSS-----SDIIIHSGWNSANL 124

  Fly   116 RNDIALLHL---NESIVFDNATQPVELDHEALVPGSRLLLTGWG-TLSLGGDVPARLQSLEVNYV 176
            ||||:|:.:   :.|........|...:..:...|...:.:||| |......|...||.:::..:
  Fly   125 RNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVI 189

  Fly   177 PFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV--HNGKLVALVNWGLP--CAKGYPD 237
            ...:|...:..|...| ..:|......:..|:||||||||  .:.:.:.|.::|..  |.||||.
  Fly   190 TNTKCAQTYGTSVVTD-STLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPA 253

  Fly   238 AHASISYYHDFIRTHLSL 255
            |...::.|.|:|:|:..:
  Fly   254 AFTRVTSYLDWIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/233 (30%)
Tryp_SPc 30..252 CDD:238113 71/235 (30%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 71/233 (30%)
Tryp_SPc 38..268 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436869
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.