DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30283

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:226 Identity:59/226 - (26%)
Similarity:103/226 - (45%) Gaps:25/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYP---PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAII 62
            :||....:|:..|.:.|.:.:|   ...::.:|:||..|....||:...:.|.| |.| |||.:|
  Fly    11 VLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEG-GFH-CGGTLI 73

  Fly    63 DERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKY--RNDIALLHLN 125
            ..|:::|:|||....:   .:|..|..:......|:.. |.:..|::|    |  ::|:|||.|.
  Fly    74 TNRFVLTSAHCIANGE---LKVRLGVLEREAEAQKFAV-DAMFVHTDY----YFDQHDLALLRLA 130

  Fly   126 ESIVFDNATQPVELDHEALVPG-----SRLLLTGWG-TLSLGGDVPARLQSLEVNYVPFEQCRAA 184
            :.:.:.:...|:.|..:.||..     .:....||| |.|....  ..||...:..:...:|...
  Fly   131 KRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSS--RMLQKTSLFNLHRSECAKQ 193

  Fly   185 HDNSTRVDIGHVCTFNDKGRGACHGDSGGPL 215
            :.:. :::..|:|. .......|:|||||||
  Fly   194 YPHQ-QINRNHICA-ESANANTCNGDSGGPL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 53/195 (27%)
Tryp_SPc 30..252 CDD:238113 53/194 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 53/195 (27%)
Tryp_SPc 43..266 CDD:238113 53/194 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.