DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG11192

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:135/265 - (50%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIIT 69
            |:.||.:..:.       |.....||||||.|.....|||:|:|  ..|.|.||||||....::|
  Fly    10 LMALVAYAGAT-------PTPGDGRIVGGEVATIQEFPYQVSVQ--LQGRHICGGAIIGIDTVLT 65

  Fly    70 AAHCTRGRQATA-FRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNA 133
            ||||.....::| :.|..|:.: |::|.......|::.|.:|.|:.:.||:|||.||..:.|...
  Fly    66 AAHCFEDPWSSADYTVRVGSSE-HESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129

  Fly   134 TQPVELDHEALVP--GSRLLLTGWG----TLSLGGD--VPARLQSLEVNYVPFEQCRAAHDNSTR 190
            .|||.|...|..|  .:||.::|||    ..::.|:  |..:|:.::|:.|...|||.|:.....
  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP 194

  Fly   191 VDIGHVCTFNDKGRGACHGDSGGPLV----HNG--KLVALVNWGLPCAK-GYPDAHASISYYHDF 248
            :....:|... .||.:|.||||||||    ..|  :|..:|:|||.||. .:|..:.:::.:..:
  Fly   195 ITRRMICAAR-PGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258

  Fly   249 IRTHL 253
            |...|
  Fly   259 IDEQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 83/235 (35%)
Tryp_SPc 30..252 CDD:238113 83/237 (35%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 83/235 (35%)
Tryp_SPc 28..262 CDD:238113 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.