DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and etaTry

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:80/257 - (31%)
Similarity:126/257 - (49%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQ----GIGSGAHSCGGAI 61
            :|.:|..|.::..||.|.         .|||||.:.::....|.:.|:    ...|.|.:|||.|
  Fly     8 ILAVLFLLGIYAVSAQSD---------GRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCI 63

  Fly    62 IDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNE 126
            :|...|.|||||...|:|..|.|:.|...............:::.|..|......|||||:.::.
  Fly    64 LDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDP 128

  Fly   127 SIVFD--NATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNST 189
            .:..|  :..:.:|:..|....|.:..::|||.....|....:||.::|..|..|:|:.|: ...
  Fly   129 PLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY-YWR 192

  Fly   190 RVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249
            .:..|.:|. .::.|:.||.||||||||...||..:|:||..||: .||..:|:::||.|:|
  Fly   193 PISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 73/227 (32%)
Tryp_SPc 30..252 CDD:238113 73/228 (32%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 73/227 (32%)
Tryp_SPc 28..257 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.