DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG12133

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:315 Identity:81/315 - (25%)
Similarity:123/315 - (39%) Gaps:64/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQIL--YPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHS------- 56
            |:....|:|.......|::.  .||   .:.||||.||.:...|:.:.|   |..|::       
  Fly    34 MVFTCCPMVAGDKLPDSRVCGQSPP---SSYIVGGMEAQSNQFPWTVLL---GYEAYTAKQRPSP 92

  Fly    57 -CGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQ--------NGSKYYYP-------DRIV 105
             |.|::|..|:::|||||.........||..|..|...        ||:|.:.|       |..|
  Fly    93 MCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRV 157

  Fly   106 EHSNYAPR--KYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRL----------LLTGWGTL 158
            .|..|..|  ::.||||||.|...:.:....:|:     .:.||..|          .:.|||..
  Fly   158 PHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI-----CIWPGIELSTSSFKNFPFQIAGWGDS 217

  Fly   159 SLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHN-GK-- 220
            .|........|.......|.|............|| .:|.....|.....||||.||:.: |:  
  Fly   218 GLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDI-QICAMGWDGTDTGLGDSGSPLMASVGRGA 281

  Fly   221 -----LVALVNW-GLPCAKGY-PDAHASISYYHDFIRTHLSLSKTDSSEDIEEEM 268
                 |..:.:: |.|.:.|| |..:...|.|:::|:..::    |.:|| |.:|
  Fly   282 DQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKIN----DIAED-ERKM 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/264 (26%)
Tryp_SPc 30..252 CDD:238113 70/266 (26%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/266 (26%)
Tryp_SPc 62..317 CDD:214473 69/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.