DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon44E

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:240 Identity:71/240 - (29%)
Similarity:113/240 - (47%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL 91
            :.||..|..|..|..||.:.| ....|.:.|||:|||..|::||||||  ..|....:..|....
  Fly    38 EGRITNGYPAYEGKIPYIVGL-SFNDGGYWCGGSIIDHTWVLTAAHCT--NSANHVLIYFGASFR 99

  Fly    92 HQNGSKY-YYPDR--IVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVEL----DHEALVPGSR 149
            |:  ::| ::..|  :::|.::.. ...|||||:.: ..:.|.:....|||    |......|..
  Fly   100 HE--AQYTHWVSRSDMIQHPDWND-FLNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWW 160

  Fly   150 LLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGP 214
            .:.:|||.......:...|..::|..:....||..:.::...| ..:|...|.|:.:|.||||||
  Fly   161 AVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITD-NTICINTDGGKSSCSGDSGGP 224

  Fly   215 LV--HNGKLVALVNWGL--PCAKGYPDAHASISYYHDFIRTHLSL 255
            ||  .|.::|.:|::|.  .|..|.|.....::.|.|:||.|..:
  Fly   225 LVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTGI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/230 (30%)
Tryp_SPc 30..252 CDD:238113 69/232 (30%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 68/230 (30%)
Tryp_SPc 41..266 CDD:238113 69/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436761
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.