DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG17572

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:118/289 - (40%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPLVLFTSSAASQILYPPQYTKNRIVGGEEAAA----GLAPY----QISLQGIGSG--AHSCGGA 60
            ||.|...||...         ||::.|......    ||..|    :|..:.:.:|  |:.|.||
  Fly   108 LPYVCCPSSPLE---------KNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGA 163

  Fly    61 IIDERWIITAAHC----TRGRQATAFRVLTGTQDLHQNGSKYYYPD-----------------RI 104
            :|..|.|:|||||    ..|.:.::.||  |..|...:      ||                 .:
  Fly   164 VIARRVILTAAHCALAKADGHRLSSVRV--GEYDTSSD------PDCANTGFCAPRSVNHAISHV 220

  Fly   105 VEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELD--HEALVPGSRLLLTGWGTLSLGGDVPAR 167
            :.|.:|...:|.:|||||.|...:.:..||||:.|.  ...||.|.|..:.|||.:|........
  Fly   221 IVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPE 285

  Fly   168 LQSLEVNYVPFEQC------RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV--HNG--KLV 222
            :..|:|....::.|      ..|.::...::...:|. ..:|:..|.|..|.||.  .||  ..:
  Fly   286 MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCA-GGEGKDVCQGFGGAPLFIQENGIFSQI 349

  Fly   223 ALVNWGLPCAKG--YPDAHASISYYHDFI 249
            .::::|.....|  .|..:.|::::.::|
  Fly   350 GIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 64/264 (24%)
Tryp_SPc 30..252 CDD:238113 65/265 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 62/250 (25%)
Tryp_SPc 138..378 CDD:214473 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.