DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG4650

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:293 Identity:66/293 - (22%)
Similarity:109/293 - (37%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQILYP--PQYTKNR---IVGGEEAAAGLAPYQISLQGIGSGAHSCGGAI 61
            ||.|||:             |  .||...|   :..|:.|....:|:...|. .....:.|||.:
  Fly    11 LLFLLPV-------------PGSSQYLDGRCGLLTNGKIANNISSPWMAYLH-TSELLYVCGGTV 61

  Fly    62 IDERWIITAAHCTRGRQATAFRV--LTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHL 124
            |.|:.::|||||||..:....|:  ..||.|.:......|...:...||.|......||||:|.|
  Fly    62 ITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGL 126

  Fly   125 NESIVFDNATQPV----------ELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFE 179
            ...|||....:|:          .:|:..::.|::     ||..:...:..| .:..::...|..
  Fly   127 ATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQ-----WGLPNDRNESDA-FRITDIRRQPAN 185

  Fly   180 QCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPL--------VHNGKLVALVNWGLPCAKGYP 236
            .|...  |.|.:.....|. .|.....|:.|...||        :....|:.:......|.:.  
  Fly   186 MCSTL--NGTAILSSQFCA-GDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKRA-- 245

  Fly   237 DAHASISYYHDFI----RTHLSLSKTDSSEDIE 265
            ..:..:..:.|||    |.:.:..|:..:.|::
  Fly   246 SVYTDVLSHTDFILSVWRQYRNGEKSPKTWDLQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 53/242 (22%)
Tryp_SPc 30..252 CDD:238113 55/245 (22%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 52/236 (22%)
Tryp_SPc 33..258 CDD:304450 52/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.