DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Try29F

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:227 Identity:77/227 - (33%)
Similarity:112/227 - (49%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQ 93
            |||||:.|.....|||:|||   ...|.|||::|.:.|::||||||.|......:|..|:... .
  Fly    41 RIVGGQVANIKDIPYQVSLQ---RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRT-S 101

  Fly    94 NGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPV----ELDHEALVPGSRLLLTG 154
            .|.:.....|:..|..:.......|.:||.|.|... .|.||..    |.|.: :..|:.:|::|
  Fly   102 VGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSA-KNVTQAFVGLPEQDAD-IADGTPVLVSG 164

  Fly   155 WGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHN 218
            ||......:..|.|:|:.|..|...||..|:.|...:....:|. ..:.|:.||.|||||||..:
  Fly   165 WGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAAD 229

  Fly   219 GKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249
            |.|..:|:||..||: .||..::.:|...|:|
  Fly   230 GVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/225 (34%)
Tryp_SPc 30..252 CDD:238113 76/226 (34%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/225 (34%)
Tryp_SPc 42..264 CDD:238113 76/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.