DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and PRSS38

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:285 Identity:78/285 - (27%)
Similarity:136/285 - (47%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYPPQ---------------YTKNRIVGGEEAAAGLAPYQISLQGIGS 52
            |:||.||:.....|:.:...|:               ..:.:|:||..|.....|:|:|:.  .:
Human    18 LLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVH--YA 80

  Fly    53 GAHSCGGAIIDERWIITAAHC-TRGRQATAFRVLTGTQDLH--QNGSKYYYPDRIVEHSNYAPRK 114
            |.|.|||:|::|.|:::|||| .|.:....:.:..|..:|.  .|.:::|..:|::.|..|  ..
Human    81 GLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQWYEVNRVILHPTY--EM 143

  Fly   115 YR---NDIALLHLNESIVFDNATQPVEL-DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNY 175
            |.   .|:||:.|...|||..:..||.| ..|..:..:....||||.:|..|:....||.:::..
Human   144 YHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPL 208

  Fly   176 VPFEQCRAAHDNSTRVDIGHVCTFND--KGRGACHGDSGGPLV----HNGKLVALVNWGLPCAKG 234
            :....|...:.:.:.:....:|. .|  ..:..|.||||||||    .:...:.:|:||..|:..
Human   209 ILEPWCHLLYGHMSYIMPDMLCA-GDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNP 272

  Fly   235 -YPDAHASISYYHDFIRTHLSLSKT 258
             ||..:||:||:..:|..::.::.|
Human   273 LYPGVYASVSYFSKWICDNIEITPT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/233 (30%)
Tryp_SPc 30..252 CDD:238113 70/235 (30%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.