DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:267 Identity:87/267 - (32%)
Similarity:130/267 - (48%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAAS-QILYP---PQYTK--NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGA 60
            :.::|.|.|...||.: |.::|   |:.||  .|||.|..|..|.|||.:.|...|:|...|||:
  Fly     3 VFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGS 67

  Fly    61 IIDERWIITAAHCTRG-RQATAF---RVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIAL 121
            ||...|::||||||.| .|.|.:   ...|..|..|..||..:     :::.|: |.:..|||||
  Fly    68 IIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDF-----IQNHNW-PNQNGNDIAL 126

  Fly   122 LHLNESIVFDNATQPVEL----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCR 182
            :. ...:.|.:....|||    |...:......:..||| |:..|..|..::.:::..:...:|.
  Fly   127 IR-TPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWG-LTTAGSQPDWMECVDLQIISNSECS 189

  Fly   183 AAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HN-GKLVALVNW--GLPCAKGYPDAHASIS 243
            ..:  .|:.| |.:|.....|:..|.|||||||| |: |:||.:.:|  |..|..|.|.....::
  Fly   190 RTY--GTQPD-GILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRVT 251

  Fly   244 YYHDFIR 250
            ...|:||
  Fly   252 NQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 75/231 (32%)
Tryp_SPc 30..252 CDD:238113 76/233 (33%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 75/231 (32%)
Tryp_SPc 37..260 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436809
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.