DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:292 Identity:87/292 - (29%)
Similarity:126/292 - (43%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTK-----------------NRIVGGEEAAAGLAPYQISLQ 48
            |.|.|..|.:..:.||:|    |:..|                 .||..|..|..|..||   :.
  Fly     1 MKLFLTVLAVAIACAAAQ----PEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPY---IV 58

  Fly    49 GIG----SGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTG------TQDLHQNGSKYYYPDR 103
            |:|    ||...|||:||...|:|||||||.|  |.:..:..|      .|..|..||.::.   
  Fly    59 GLGFSSDSGGWWCGGSIIGHTWVITAAHCTHG--AHSVTIYYGALWRLQAQYTHTVGSGHFR--- 118

  Fly   104 IVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELD-----HEALVPGSRLLLTGWGTLSLGGD 163
              :||:|......|||:|:: ...:.|.:....|||.     |::.. |...|.:|||.......
  Fly   119 --QHSDYNTNNLNNDISLIN-TPHVDFWHLINKVELPDGNERHDSFA-GWWALASGWGRPCDSCG 179

  Fly   164 VPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HN-GKLVALVN 226
            |...|..::...:..::|.:.:......| ..:||....|:..|.|||||||| |: .|||.:.:
  Fly   180 VSDYLNCVDSQIITRDECSSVYGTDVITD-NVICTSTPGGKSTCAGDSGGPLVLHDRSKLVGVTS 243

  Fly   227 W--GLPCAKGYPDAHASISYYHDFIRTHLSLS 256
            :  ...|..|.||....::.|.|:||.|..:|
  Fly   244 FVAASGCTSGLPDGFTRVTSYLDWIRDHTGIS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/238 (31%)
Tryp_SPc 30..252 CDD:238113 75/240 (31%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 74/238 (31%)
Tryp_SPc 43..271 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436767
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.