DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Ser12

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:246 Identity:75/246 - (30%)
Similarity:121/246 - (49%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDER 65
            |||..|.||      ||..|.....:..|||||........|:|.:|  :.|..:.||..|..::
  Fly     1 MLLHWLVLV------ASVTLISAGSSPERIVGGHPVLISEVPWQAAL--MYSEKYICGAVIYSDK 57

  Fly    66 WIITAAHCTRGRQATAFRVLTGTQDLHQN-GSKYYYPDRIVEHSNYAPRKYR-NDIALLHLNESI 128
            .|||||||......|.:.|..|:  :.:| |.::.....|.:|.:|...... ||||::.|.:::
  Fly    58 IIITAAHCVERPFDTLYSVRVGS--VWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTL 120

  Fly   129 VFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDI 193
            :|:...:|::|...|...|:...::|||.:.:....|..|....|..:....|:.::...|:..|
  Fly   121 IFNAEVRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQYITKTMI 185

  Fly   194 GHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKG-YPDAHASIS 243
            .......|    :||||||||||..|:||.:|::|:.||.. :|..:|:::
  Fly   186 CAAALLKD----SCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 66/218 (30%)
Tryp_SPc 30..252 CDD:238113 65/217 (30%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 66/218 (30%)
Tryp_SPc 24..238 CDD:238113 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.