DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG1304

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:268 Identity:80/268 - (29%)
Similarity:130/268 - (48%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDER 65
            :||:.:|:    .||       |.....|:||||:|.....|:|:||:..||  |||||:|:...
  Fly    14 LLLLAVPV----HSA-------PGSLNGRVVGGEDAVKNQFPHQVSLRNAGS--HSCGGSILSRN 65

  Fly    66 WIITAAHCTRGRQ---------ATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIAL 121
            :::|||||...:.         |..|.:..|:.|....|......:.|| |..|.  .:.||:||
  Fly    66 YVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIV-HEEYG--NFLNDVAL 127

  Fly   122 LHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHD 186
            |.|...::...:.||::|..........::::|||.:...||:|..||...:..:..|:|...  
  Fly   128 LRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDEL-- 190

  Fly   187 NSTRVDIG-----HVCTFNDKGRGACHGDSGGPLVHNGKLVALVN--WGLPCAKGYPDAHASISY 244
                  ||     .:|..::...|||:||||||.|:|.::|.:..  |. .|...|||.:|.:.|
  Fly   191 ------IGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWS-ACGTSYPDGYARVYY 248

  Fly   245 YHDFIRTH 252
            ::::|:.:
  Fly   249 HNEWIKNN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 73/235 (31%)
Tryp_SPc 30..252 CDD:238113 73/237 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/235 (31%)
Tryp_SPc 32..256 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.