DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Hayan

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:244 Identity:63/244 - (25%)
Similarity:114/244 - (46%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVGGEEAAAGLAPYQ--ISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH 92
            |:.||....|:.|:.  |:....||.|..|||::|..|:::|||||.....:|...|..|..:: 
  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNI- 448

  Fly    93 QNGSKYYYPDRIVE---HSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGS--RLLL 152
            :|....|....:::   |.:|:......|||:|.|.|.....:..:|..|..:...|.:  :..:
  Fly   449 ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFV 513

  Fly   153 TGWGTLSLGGDVPAR-LQSLEVNYVPFEQCRAA---HDNSTR-----VDIGHVCTFN-DKGRGAC 207
            .|||.:::.....:: |....::.||.::|.|:   ..::.|     |....:|..: ::.:.||
  Fly   514 AGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDAC 578

  Fly   208 HGDSGGPLV-------HNGKLVALVNWGLPCAKGYPDAHASISYYHDFI 249
            .|||||||:       ....:|.:::.|..||...|..:..:|.:.|:|
  Fly   579 QGDSGGPLILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 62/242 (26%)
Tryp_SPc 30..252 CDD:238113 63/244 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 62/242 (26%)
Tryp_SPc 385..630 CDD:238113 63/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437648
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.