DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and sphe

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:121/262 - (46%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            |::|.|:..|:....       :.:.||:|||:|.|....:..||:  ...||.|||:|:.:..|
  Fly     6 LVILGLIGLTAVGMC-------HAQGRIMGGEDADATATTFTASLR--VDNAHVCGGSILSQTKI 61

  Fly    68 ITAAHCTR--GRQATAFRVLTGTQDLHQ-NGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIV 129
            :|.|||..  |:...|.|:.......:| .|.|....:.:..|.:|  ....|::|::.|:..:.
  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELT 124

  Fly   130 F-DNATQ-PVELDHEAL-VPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAA---HDNS 188
            : |..|. |:....||| ..||.:::.|||..| .|....:::.:.:...|...|..|   ||..
  Fly   125 YTDRITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQ 188

  Fly   189 TRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PCAKGYPDAHASISYYHDFIRTH 252
            :      .|..::...|.||||.||..::...|:.|.|:.: .|...|||....:|.|.|:|:..
  Fly   189 S------FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247

  Fly   253 LS 254
            ::
  Fly   248 IA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/229 (29%)
Tryp_SPc 30..252 CDD:238113 67/231 (29%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/215 (28%)
Tryp_SPc 42..244 CDD:214473 60/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.