DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG9676

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:79/262 - (30%)
Similarity:129/262 - (49%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPL--VLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            :||.  .|....||..:.......:.|||||.:|..|..|:||||:..||  |:|||:||.:.::
  Fly     1 MLPFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGS--HTCGGSIISKDYV 63

  Fly    68 ITAAHCTR-GRQ---ATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESI 128
            :|||||.: |..   |....:..|:..|...|.:.... .:..|.||  ....:|:|:|.|..|:
  Fly    64 VTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVA-TVTVHPNY--NSNGHDVAVLRLRNSL 125

  Fly   129 VFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAH----DNST 189
            .|::....::|..|.....:.:.::|||.:|..|.:...|..::|..:..|.|:..:    ..:|
  Fly   126 TFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT 190

  Fly   190 RVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PCAKGYPDAHASISYYHDFIRTHL 253
                  :|..:.|.:|||:||||||..:.||||.|.::.: .|.:..||.:..:|...::|....
  Fly   191 ------MCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249

  Fly   254 SL 255
            ||
  Fly   250 SL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/228 (31%)
Tryp_SPc 30..252 CDD:238113 71/230 (31%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/228 (31%)
Tryp_SPc 28..248 CDD:238113 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.