DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG8952

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:274 Identity:78/274 - (28%)
Similarity:118/274 - (43%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYP----PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAI 61
            ::|:||..:    |...|...|    |....||||.|.:|..|..|:|:.|:........|||:|
  Fly     9 LMLVLLAAI----SVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSI 69

  Fly    62 IDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNE 126
            |.:.|::||||||.|  .::..::.||.||....:.....:.|:.|.:|.. |..||::|:.|.|
  Fly    70 ISDTWVLTAAHCTNG--LSSIFLMFGTVDLFNANALNMTSNNIIIHPDYND-KLNNDVSLIQLPE 131

  Fly   127 SIVFDNATQPVEL--------DHEALVPGSRLLLTGWG-TLSLGGDVPARLQSLEVNYVPFEQCR 182
            .:.|....|.::|        |:    .||...:.|:| |.....|....|...:|..:....|.
  Fly   132 PLTFSANIQAIQLVGQYGDSIDY----VGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCV 192

  Fly   183 AAHDNSTRVDIGHVCT--FNDKGRGACHGDSGGPLVHNGKLVALVNW---GL-------PCAKGY 235
            |.:.....|| ..:|.  |:......|.|||||||:...|.:.  .|   |:       .|....
  Fly   193 AIYGKYVVVD-STMCAKGFDGSDMSTCTGDSGGPLILYNKTIQ--QWQQIGINSFVAEDQCTYRL 254

  Fly   236 PDAHASISYYHDFI 249
            |..:|.:|.:..||
  Fly   255 PSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/240 (28%)
Tryp_SPc 30..252 CDD:238113 69/241 (29%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 68/240 (28%)
Tryp_SPc 38..271 CDD:238113 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436911
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.